PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK21090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 427aa    MW: 46811.1 Da    PI: 5.941
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK21090.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS368.96.6e-113654243374
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                 lLl+cAe v+ ++l++a  lL ++ el+sp g++ +R+ ayf+ AL+ar+ +s  + y+ l++++ + ++s + ++al+ ++ +sP++kfsh+taNqaI
  PK21090.1  65 GLLLQCAESVAMDNLNNAGDLLPEIAELSSPFGTSPERVGAYFAHALQARVISSYLGRYSPLTTKTINLTQSHRIFNALQSYNSISPLVKFSHFTANQAI 164
                58******************************************************************99****************************** PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEal 202
                 +a++g +rvH+iD+di+qGlQWp L++ LasR+++  s+RiTg+gs    s+e le+tg+rLa+fA++lg+pfef++l  k  +  ++++L+v+p+Ea+
  PK21090.1 165 FQALDGVDRVHVIDLDIMQGLQWPGLFHILASRSRKIRSMRITGFGS----STELLESTGRRLADFASSLGLPFEFHPLEGKIGSITDPSQLDVRPNEAT 260
                ***********************************************....99*************************988899999************* PP

       GRAS 203 aVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvaceg 302
                +V++++  h l+d ++s       +L+l+  l+Pk++++veq+++h ++sFl rf+eal+yysalfd+l    +++s er++vE++l+g ei+n+va  g
  PK21090.1 261 VVHWMH--HCLYDITGSDLG----TLRLLSLLRPKLITIVEQDLSH-GGSFLGRFVEALHYYSALFDALGDVSGADSLERHMVEQQLFGCEIRNIVAVGG 353
                ****99..777777777777....9*********************.789*******************7777*************************** PP

       GRAS 303 aerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 +r+ + + + +W e l+++GFkp++l+ + a+qa+lll +++++gy++ eesg+l lgWkd +L+++SaW+
  PK21090.1 354 PKRTGEVK-VDRWGEELKRVGFKPISLGGNPAAQASLLLGMYPWKGYTLVEESGCLKLGWKDLSLLTASAWQ 424
                **998887.9*************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.23637404IPR005202Transcription factor GRAS
PfamPF035142.3E-11065424IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MKTKRVEREI SAPGETVSED PSTKRPANSA RNFSDDATIS GDKAVNDQEE ELVVEGESSG  60
LRLLGLLLQC AESVAMDNLN NAGDLLPEIA ELSSPFGTSP ERVGAYFAHA LQARVISSYL  120
GRYSPLTTKT INLTQSHRIF NALQSYNSIS PLVKFSHFTA NQAIFQALDG VDRVHVIDLD  180
IMQGLQWPGL FHILASRSRK IRSMRITGFG SSTELLESTG RRLADFASSL GLPFEFHPLE  240
GKIGSITDPS QLDVRPNEAT VVHWMHHCLY DITGSDLGTL RLLSLLRPKL ITIVEQDLSH  300
GGSFLGRFVE ALHYYSALFD ALGDVSGADS LERHMVEQQL FGCEIRNIVA VGGPKRTGEV  360
KVDRWGEELK RVGFKPISLG GNPAAQASLL LGMYPWKGYT LVEESGCLKL GWKDLSLLTA  420
SAWQPSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-47634244375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010093140.10.0hypothetical protein L484_009332
SwissprotQ9FHZ10.0SCL23_ARATH; Scarecrow-like protein 23
TrEMBLW9QSP90.0W9QSP9_9R
STRINGPOPTR_0016s02030.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.11e-178GRAS family protein